toonpool logo
  • Agent
  • Collections
  • plus
    • Communauté
    • Membres
    • Pro Search
    • Aide
  • Se connecter




    • Password lost?
  • Enregistrer
  • français
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nouveaux Cartoons
Cartoon: Sonntagspredigerin (medium) by RABE tagged klimawandel,umwelt,umweltministerin,schulze,sp,klimapreis,heizung,auto,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,brücke,bettler,verkehr,klimaprämie,friday,for,future,leitungswasser,wasser,predigerin,kirche,kanzel,michel,wasserhahn,vielflieger,kerosin,umweltbelastung,wein,weinlieferant,weinfass,tröpfchen,klimawandel,umwelt,umweltministerin,schulze,sp,klimapreis,heizung,auto,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,brücke,bettler,verkehr,klimaprämie,friday,for,future,leitungswasser,wasser,predigerin,kirche,kanzel,michel,wasserhahn,vielflieger,kerosin,umweltbelastung,wein,weinlieferant,weinfass,tröpfchen

Sonntagspredigerin

#341675 / vu 3287 fois
RABE de RABE
au 15. August 2019
rating-star 5
Applause
favorite
Favori
report spam
Signaler

Ohne Worte

Politique »  National/Domestic  International  Elections  Military & Security  Taxes  Third World  Terrorism  Finances  Pension  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Jobs & Social  Immigration  Fraud & Corruption  Historical  Other  Conflicts & War  Politicians  Parties  Privacy & Customer  Democracy  Energy

klimawandelumweltumweltministerinschulzespklimapreisheizungautoraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoonbrückebettlerverkehrklimaprämiefridayforfutureleitungswasserwasserpredigerinkirchekanzelmichelwasserhahnvielfliegerkerosinumweltbelastungweinweinlieferantweinfasströpfchenklimawandelumweltumweltministerinschulzespklimapreisheizungautoraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoonbrückebettlerverkehrklimaprämiefridayforfutureleitungswasserwasserpredigerinkirchekanzelmichelwasserhahnvielfliegerkerosinumweltbelastungweinweinlieferantweinfasströpfchen

Commentaires (5)

 
Paolo Calleri
Member
dass sie immer zur unpassendsten zeit reinplatzen müssen :0))

Paolo Calleri, au 16. August 2019  aviser  repondre applause 0

 
Barthold
Member
natürlich trinken die Regierungsleute lieber Wasser!
. . . aber irgendwie muss der Wein schließlich auch weg!

Barthold, au 15. August 2019  aviser  repondre applause 0

 
Harm Bengen
Member
weinfass zum heulen.

Harm Bengen, au 15. August 2019  aviser  repondre applause 0

 
Erl
Member
Leitungswasser predigen und Fasswein trinken.

Erl, au 15. August 2019  aviser  repondre applause 0

 
JotKa
Member
So sind sie halt.*****

JotKa, au 15. August 2019  aviser  repondre applause 0

 
 

Ajouter commentaires
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Plus de RABE


Cartoon: Nochmal Aprilscherzartikel (small) by RABE tagged fake,news,april,aprilscherze,abreisskalender,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,nachrichten,journalismus,politikerlügen,fakes
Nochmal Aprilscherzartikel
Cartoon: Neue Verordnung für Feger (small) by RABE tagged schornsteinfeger,glücksbringer,schwarz,russ,besen,schornstein,schlot,esse,kamin,rauch,rauchabzug,ofen,feuer,feuerstätte,heizung,reinigung,fachpersonal,eu,verordnung,hölle,teufel,satan,höllenfeuer
Neue Verordnung für Feger
Cartoon: Kochsalz für alle (small) by RABE tagged ampel,ampelregierung,rot,grün,gelb,fdp,spd,grüne,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,inflation,einkommen,rente,rentenpaket,bruch,streit,neuwahlen,karl,lauterbach,kochsalz,kochsalzlösung,engpass,nobelpreis,chemie,schweden,akademie,stockholm,protein
Kochsalz für alle
  • Service

  • ToonAgent
  • Aide
  • FAQ
  • Daily Toon
  • Sur nous

  • Sur nous
  • Contact
  • Conditions d'utilisation
  • Protection des données
  • Manage cookies
  • Communauté

  • Communauté
  • Pro Search
  • Collections
  • Enregistrer
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.