toonpool logo
  • Agent
  • Collections
  • plus
    • Communauté
    • Membres
    • Pro Search
    • Aide
  • Se connecter




    • Password lost?
  • Enregistrer
  • français
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nouveaux Cartoons
Cartoon: Das schaffen wir! (medium) by SoRei tagged merkel,das,schaffen,wir,stammtisch,kneipe,stammtischpolitik,alkohol,rechtsstaatlichkeit,wohlstand,geister,flüchtlingswelle,flüchtlingskrise,asyldiskussion,asylrecht,bleiberecht,flucht,flüchtlingsschwemme,optimismus,riss,in,der,gesellschaft,integration,asylpolitik,merkel,das,schaffen,wir,stammtisch,kneipe,stammtischpolitik,alkohol,rechtsstaatlichkeit,wohlstand,geister,flüchtlingswelle,flüchtlingskrise,asyldiskussion,asylrecht,bleiberecht,flucht,flüchtlingsschwemme

Das schaffen wir!

#257062 / vu 6242 fois
SoRei de SoRei
au 15. October 2015
rating-star 1
Applause
favorite
Favori
report spam
Signaler

Stammtischpolitik nervt mehr denn je.

Politique »  National/Domestic  International  Finances  Economy & Money  Immigration  Other  Conflicts & War  Politicians  Democracy

merkeldasschaffenwirstammtischkneipestammtischpolitikalkoholrechtsstaatlichkeitwohlstandgeisterflüchtlingswelleflüchtlingskriseasyldiskussionasylrechtbleiberechtfluchtflüchtlingsschwemmeoptimismusrissindergesellschaftintegrationasylpolitikmerkeldasschaffenwirstammtischkneipestammtischpolitikalkoholrechtsstaatlichkeitwohlstandgeisterflüchtlingswelleflüchtlingskriseasyldiskussionasylrechtbleiberechtfluchtflüchtlingsschwemme

Commentaires (3)

 
Jenaerin
Member
Beides!

Jenaerin, au 27. September 2019  aviser  repondre applause 0

 
SoRei
Member
Doch. Ich schon!

SoRei, au 19. October 2015  aviser  repondre applause 0

 
JotKa
Member
:-))

JotKa, au 19. October 2015  aviser  repondre applause 0

 
 

Ajouter commentaires
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Plus de SoRei


Cartoon: Frühling (small) by SoRei tagged virus,corona,mutation,mutant,hülle,keime,gene,ändern,viren,erbgut,dns,rns,zellen,infizieren,wirtszelle,proteine,erreger,nachkommen,reproduktionszyklus,immunsystem,erkennen,gendrift,genshift,enzyme,polymerasen,vervielfältigen,vermehren,kopieren,varianten,neu,kreation,flirt,anbaggern,anmachen,unmoralisches,angebot,sex,dating,special,interest,anzüglich,verführen,betören,eiweis,peptide,forschung,biologie,medizien,mikrokosmos,kommunikation,nachwuchs,gesundheit,symbiose,pandemie
Frühling
Cartoon: 72 (small) by SoRei tagged polizist,prostituierte,kontrolle,recht,auf,religionsausübung,religionsfreiheit,72,jungfrauen,vorwand,ausflüchte,uniform,tanktop,zigarette,minirock,overknees,bauchfrei,straße,schminke,anschaffen,koran,paradies,märtyrer,skepsis
72
Cartoon: Ostern entfällt (small) by SoRei tagged osterhase,karotten,kolik,osterfest,ostersonntag,karfreitag,fest,auferstehung,christlich,konsum
Ostern entfällt
  • Service

  • ToonAgent
  • Aide
  • FAQ
  • Daily Toon
  • Sur nous

  • Sur nous
  • Contact
  • Conditions d'utilisation
  • Protection des données
  • Manage cookies
  • Communauté

  • Communauté
  • Pro Search
  • Collections
  • Enregistrer
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.