toonpool logo
  • Agent
  • Collections
  • plus
    • Communauté
    • Membres
    • Pro Search
    • Aide
  • Se connecter




    • Password lost?
  • Enregistrer
  • français
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nouveaux Cartoons
Cartoon: Wadephul dichtet (medium) by RABE tagged merz,union,kanzler,fritze,koalition,spd,klingbeil,bundesregierung,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,trump,putin,krisen,tv,nachrichten,waschmaschine,wadephul,außenminister,deutschland,china,peking,handel,drache,weihnachten,gedicht,weihnachtsgedicht,erden,rohstoffe,chips,wunschliste,wunschzettel,merz,union,kanzler,fritze,koalition,spd,klingbeil,bundesregierung,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,trump,putin,krisen,tv,nachrichten,waschmaschine,wadephul,außenminister,deutschland,china,peking,handel,drache,weihnachten,gedicht,weihnachtsgedicht,erden,rohstoffe,chips,wunschliste,wunschzettel

Wadephul dichtet

#475250 / vu 1246 fois
RABE de RABE
au 08. December 2025
rating-star 3
Applause
favorite
Favori
report spam
Signaler

Ohne Worte

Politique »  National/Domestic  International  Elections  Taxes  Finances  Pension  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Jobs & Social  Fraud & Corruption  Historical  Other  Politicians  Parties  Democracy

merzunionkanzlerfritzekoalitionspdklingbeilbundesregierungraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoontrumpputinkrisentvnachrichtenwaschmaschinewadephulaußenministerdeutschlandchinapekinghandeldracheweihnachtengedichtweihnachtsgedichterdenrohstoffechipswunschlistewunschzettelmerzunionkanzlerfritzekoalitionspdklingbeilbundesregierungraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoontrumpputinkrisentvnachrichtenwaschmaschinewadephulaußenministerdeutschlandchinapekinghandeldracheweihnachtengedichtweihnachtsgedichterdenrohstoffechipswunschlistewunschzettel

Commentaires (4)

 
Harm Bengen
Member
haben sie mal feuer, herr drache?

Harm Bengen, au 08. December 2025  aviser  repondre applause 0

 
markus-grolik
Member
...aus dem Land der Dichter und Denker

markus-grolik, au 08. December 2025  aviser  repondre applause 0

 
MorituruS
Member
Xi jind der allerbeste, Herr Ping!

MorituruS, au 08. December 2025  aviser  repondre applause 0

 
Erl
Member
Ich bin klein, mein Wunsch ist klein ...

Erl, au 08. December 2025  aviser  repondre applause 0

 
 

Ajouter commentaires
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Plus de RABE


Cartoon: Impftermineauslosung (small) by RABE tagged corona,bildung,bildungsminister,kanzleramt,bildungskonferenz,lehrerkonferenz,laptop,ausstatung,digitalisierung,bildungsmonitor,internetzugan,wlan,aufwachen,schnelltest,lockdown,shutdown,impfzentrum,impftermin,impfstoff,mutation,fallzahlen,rki,intensivbetten,lostrommel,auslosung,nachrichten,news,tombola
Impftermineauslosung
Cartoon: Verschnupft (small) by RABE tagged ampel,ampelregierung,rot,grün,gelb,fdp,spd,grüne,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,inflation,einkommen,rente,rentenpaket,bruch,streit,neuwahlen,vertrauensfrage,landtagswahl,erkältung,schnupfen,apotheke
Verschnupft
Cartoon: Kochsalz für alle (small) by RABE tagged ampel,ampelregierung,rot,grün,gelb,fdp,spd,grüne,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,inflation,einkommen,rente,rentenpaket,bruch,streit,neuwahlen,karl,lauterbach,kochsalz,kochsalzlösung,engpass,nobelpreis,chemie,schweden,akademie,stockholm,protein
Kochsalz für alle
  • Service

  • ToonAgent
  • Aide
  • FAQ
  • Daily Toon
  • Sur nous

  • Sur nous
  • Contact
  • Conditions d'utilisation
  • Protection des données
  • Manage cookies
  • Communauté

  • Communauté
  • Pro Search
  • Collections
  • Enregistrer
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.