toonpool logo
  • Agent
  • Collections
  • plus
    • Communauté
    • Membres
    • Pro Search
    • Aide
  • Se connecter




    • Password lost?
  • Enregistrer
  • français
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nouveaux Cartoons
Cartoon: Von drauß (medium) by RABE tagged corona,bundländerkonferenz,merkel,kanzleramt,lockerungen,stufenplan,öffnungen,lockdown,shutdown,baumärkte,impfdosen,rki,fallzahlen,inzidenzwert,spahn,impfzentren,impfreihenfolge,notbremse,stiko,kinder,kinderimpfpflicht,weihnachten,weihnachtsmann,geschenke,korridortüre,corona,bundländerkonferenz,merkel,kanzleramt,lockerungen,stufenplan,öffnungen,lockdown,shutdown,baumärkte,impfdosen,rki,fallzahlen,inzidenzwert,spahn,impfzentren,impfreihenfolge,notbremse,stiko,kinder,kinderimpfpflicht,weihnachten,weihnachtsmann,geschenke,korridortüre

Von drauß

#396393 / vu 3904 fois
RABE de RABE
au 13. December 2021
rating-star 3
Applause
favorite
Favori
report spam
Signaler

Ohne Worte

Politique »  National/Domestic  Elections  Taxes  Finances  Pension  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Jobs & Social  Fraud & Corruption  Historical  Other  Politicians  Parties  Privacy & Customer  Democracy  Energy

coronabundländerkonferenzmerkelkanzleramtlockerungenstufenplanöffnungenlockdownshutdownbaumärkteimpfdosenrkifallzahleninzidenzwertspahnimpfzentrenimpfreihenfolgenotbremsestikokinderkinderimpfpflichtweihnachtenweihnachtsmanngeschenkekorridortürecoronabundländerkonferenzmerkelkanzleramtlockerungenstufenplanöffnungenlockdownshutdownbaumärkteimpfdosenrkifallzahleninzidenzwertspahnimpfzentrenimpfreihenfolgenotbremsestikokinderkinderimpfpflichtweihnachtenweihnachtsmanngeschenkekorridortüre

Collections

(1)
Santa

Commentaires (4)

 
Harm Bengen
Member
der stikolaus.

Harm Bengen, au 13. December 2021  aviser  repondre applause 0

 
Erl
Member
Das Gedicht verstehen sie!

Erl, au 13. December 2021  aviser  repondre applause 0

 
marian kamensky
Member
Ultraromantisch!

marian kamensky, au 13. December 2021  aviser  repondre applause 0

 
Guest Avatar
Deleted
Macht nichts. Die Leute haben eh schon alles.

, au 13. December 2021  aviser  repondre applause 0

 
 

Ajouter commentaires
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Plus de RABE


Cartoon: Fotowand (small) by RABE tagged ampel,ampelregierung,rot,grün,gelb,fdp,spd,grüne,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,pöbelei,pöbler,bestrafung,regelung,beschimpfung,bundestag,abgeordnete,bundesvorstand,rücktritt,neustart,bewerbung,fotowand
Fotowand
Cartoon: Retortenburger (small) by RABE tagged burger,retortenburger,gewebe,gewebezüchterei,metzgerei,metzger,fleischer,fleischerei,fleisch,enzyme,labor,wissenschaftler,reagenzglas,stammzellen,rinderstammzellen,fleischklops,niederlande,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,wurs
Retortenburger
Cartoon: Powersnack (small) by RABE tagged merz,union,kanzler,fritze,koalition,spd,klingbeil,bundesregierung,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,trump,putin,krisen,tv,nachrichten,ard,sommerinterview,protest,störung,störkampagne,linke,rechte,muskel,muskelaufbau,powersnack,bizeps
Powersnack
  • Service

  • ToonAgent
  • Aide
  • FAQ
  • Daily Toon
  • Sur nous

  • Sur nous
  • Contact
  • Conditions d'utilisation
  • Protection des données
  • Manage cookies
  • Communauté

  • Communauté
  • Pro Search
  • Collections
  • Enregistrer
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.