toonpool logo
  • Agent
  • Collections
  • plus
    • Communauté
    • Membres
    • Pro Search
    • Aide
  • Se connecter




    • Password lost?
  • Enregistrer
  • français
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nouveaux Cartoons
Cartoon: The pandemic system (medium) by Enrico Bertuccioli tagged pandemic,cornavirus,covid19,virus,viral,economy,money,business,speculaiton,speculators,experiment,social,socialmedia,people,society,strategy,political,policy,politicians,inetrnational,global,national,crisis,data,bigdata,dataprotection,fakenews,news,fake,system,finance,financial,problem,government,pandemic,cornavirus,covid19,virus,viral,economy,money,business,speculaiton,speculators,experiment,social,socialmedia,people,society,strategy,political,policy,politicians,inetrnational,global,national,crisis,data,bigdata,dataprotection,fakenews,news,fake,system,finance,financial,problem,government

The pandemic system

#388974 / vu 3932 fois
Enrico Bertuccioli de Enrico Bertuccioli
au 06. August 2021
rating-star 3
Applause
favorite
Favori
report spam
Signaler

Are we all part of the same social experiment?

Politique »  National/Domestic  International  Elections  Finances  Economy & Money  Technology  Environment  Health  Family & Youth  Jobs & Social  Fraud & Corruption  Politicians  Parties  Privacy & Customer  Democracy

pandemiccornaviruscovid19virusviraleconomymoneybusinessspeculaitonspeculatorsexperimentsocialsocialmediapeoplesocietystrategypoliticalpolicypoliticiansinetrnationalglobalnationalcrisisdatabigdatadataprotectionfakenewsnewsfakesystemfinancefinancialproblemgovernmentpandemiccornaviruscovid19virusviraleconomymoneybusinessspeculaitonspeculatorsexperimentsocialsocialmediapeoplesocietystrategypoliticalpolicypoliticiansinetrnationalglobalnationalcrisisdatabigdatadataprotectionfakenewsnewsfakesystemfinancefinancialproblemgovernment

Commentaires (0)

Ajouter commentaires  
 

Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Plus de Enrico Bertuccioli


Cartoon: The nuclear spyral (small) by Enrico Bertuccioli tagged putin,russia,ukraine,war,ukrainewar,worldwar,nuclearwar,political,zelensky,nuclearmenace,nuclearweapon,nuclearbomb,escalation,authocracy,authoritarianism,dictatorship,government,security,safety,deadlyweapons
The nuclear spyral
Cartoon: Political propaganda (small) by Enrico Bertuccioli tagged propaganda,populism,populist,populistpropaganda,politician,promises,fakepromises,falsepromises,truth,manipulation,politicalpropaganda,political,politicalcartoons,editorialcartoon
Political propaganda
Cartoon: The claw of big tech (small) by Enrico Bertuccioli tagged world,newworldorder,technology,bigtech,technologicaldomain,domain,data,bigdata,power,control,neocapitalism,capitalism,technologicalcapitalism,digital,digitalcapitalism,money,business,economy,greed,dictatorship,political,politicalcartoon,editorialcartoon
The claw of big tech
  • Service

  • ToonAgent
  • Aide
  • FAQ
  • Daily Toon
  • Sur nous

  • Sur nous
  • Contact
  • Conditions d'utilisation
  • Protection des données
  • Manage cookies
  • Communauté

  • Communauté
  • Pro Search
  • Collections
  • Enregistrer
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.