toonpool logo
  • Agent
  • Collections
  • plus
    • Communauté
    • Membres
    • Pro Search
    • Aide
  • Se connecter




    • Password lost?
  • Enregistrer
  • français
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nouveaux Cartoons
Cartoon: Strasse von Hormus (medium) by leopold maurer tagged hormus,trump,krieg,meerenge,schiffe,wirtschaft,welt,öl,ölpreis,finanzmärkte,entern,blockieren,minen,marine,nahost,iran,israel,usa,strasse,blockade,leopold,maurer,karikatur,cartoon,hormus,trump,krieg,meerenge,schiffe,wirtschaft,welt,öl,ölpreis,finanzmärkte,entern,blockieren,minen,marine,nahost,iran,israel,usa,strasse,blockade,leopold,maurer,karikatur,cartoon

Strasse von Hormus

#482700 / vu 1508 fois
leopold maurer de leopold maurer
au 20. April 2026
rating-star 7
Applause
favorite
Favori
report spam
Signaler

---

Politique »  National/Domestic  International

hormustrumpkriegmeerengeschiffewirtschaftweltölölpreisfinanzmärkteenternblockierenminenmarinenahostiranisraelusastrasseblockadeleopoldmaurerkarikaturcartoonhormustrumpkriegmeerengeschiffewirtschaftweltölölpreisfinanzmärkteenternblockierenminenmarinenahostiranisraelusastrasseblockadeleopoldmaurerkarikaturcartoon

Commentaires (4)

 
Harm Bengen
Member
super!

Harm Bengen, au 22. April 2026  aviser  repondre applause 0

 
Enrico Bertuccioli
Member
OUCH!

Enrico Bertuccioli, au 21. April 2026  aviser  repondre applause 0

 
Erl
Member
Guten Rutsch möchte man da nicht wünschen ...

Erl, au 20. April 2026  aviser  repondre applause 0

 
MorituruS
Member
Too much Rutsch!

MorituruS, au 20. April 2026  aviser  repondre applause 0

 
 

Ajouter commentaires
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Plus de leopold maurer


Cartoon: Rezession (small) by leopold maurer tagged habeck,ampel,regierung,minister,wirtschaft,rezession,konjunkturprognose,nobelpreis,protein,verleihung,traum,loesung,problem,leopold,maurer,karikatur,cartoon
Rezession
Cartoon: Mangellehre (small) by leopold maurer tagged bundeswehr,bildung,gesundheit,mangel,wehrbericht,bildungsgipfel,pflege,kommunen,krankenhäuser,schule,ausrüstung,budget,geld,lehrerin,schüler,mengenlehre,leopold,maurer,cartoon,karikatur
Mangellehre
Cartoon: NRW Wahl (small) by leopold maurer tagged nrw,wahl,cdu,spd,afd,dritter,platz,sieger,kommunalwahlen,verdreifachen,grüne,linke,leopold,maurer,deutschland,cartoon,karikatur
NRW Wahl
  • Service

  • ToonAgent
  • Aide
  • FAQ
  • Daily Toon
  • Sur nous

  • Sur nous
  • Contact
  • Conditions d'utilisation
  • Protection des données
  • Manage cookies
  • Communauté

  • Communauté
  • Pro Search
  • Collections
  • Enregistrer
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.