toonpool logo
  • Agent
  • Collections
  • plus
    • Communauté
    • Membres
    • Pro Search
    • Aide
  • Se connecter




    • Password lost?
  • Enregistrer
  • français
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nouveaux Cartoons
Cartoon: Lack of Intelligence (medium) by KI-Vossy tagged usa,trump,intelligece,health,vaccine,marks,fda,drugs,disinformation,lies,kennedy,resistance,media,pressure,immune,potus,usa,trump,intelligece,health,vaccine,marks,fda,drugs,disinformation,lies,kennedy,resistance,media,pressure

Lack of Intelligence

#461197 / vu 1648 fois
KI-Vossy de KI-Vossy
au 29. March 2025
rating-star 3
Applause
favorite
Favori
report spam
Signaler

The U.S. government's top vaccine expert, Peter Marks, has resigned as head of the FDA's vaccine division, which oversees drug and food safety.

The New York Times and the Washington Post both reported the news. Marks described his move as a protest against "disinformation and lies" following the appointment of U.S. Secretary of Health and Human Services Robert F. Kennedy Jr.

In his resignation letter, he complained of "unprecedented attacks on scientific truth" by the secretary and his supporters.

According to US media reports, Marks may also have been pressured into resigning.

He probably had too little resistance

Politique »  National/Domestic  Finances  Economy & Money  Health  Family & Youth  Education  Confederations  Jobs & Social  Historical  Other  Politicians  Parties  Privacy & Customer  Democracy

usatrumpintelligecehealthvaccinemarksfdadrugsdisinformationlieskennedyresistancemediapressureimmunepotususatrumpintelligecehealthvaccinemarksfdadrugsdisinformationlieskennedyresistancemediapressure

Collections

(3)
Political Cartoons - International!
PRESIDENT DONALD TRUMP
U.S.A

Commentaires (1)

 
Enrico Bertuccioli
Member
Good one.

Enrico Bertuccioli, au 31. March 2025  aviser  repondre applause 0

 
 

Ajouter commentaires
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Plus de KI-Vossy


Cartoon: Don the Decorator (small) by KI-Vossy tagged republikaner,hakenkreuz,taylor,flagge,usa,washington,trump,republicans,meeting,flag,us,swastika,motif,republican,cross,right,wing,politiker,weiße,haus,decoration,decorations,decorator,paint,brown,potus
Don the Decorator
Cartoon: Simple as that ... (small) by KI-Vossy tagged urkraine,russia,usa,zelensky,putin,trump,potus,peace,plan,treaty,war,document,friede,frieden,friedensplan,umerow,kapitulation,surrender
Simple as that ...
Cartoon: Szene einer Ehe (small) by KI-Vossy tagged trump,melania,donald,usa,zellulitis,ehe,bergman,film,filmdrama,rapunzel,geständnis,flotus,potus
Szene einer Ehe
  • Service

  • ToonAgent
  • Aide
  • FAQ
  • Daily Toon
  • Sur nous

  • Sur nous
  • Contact
  • Conditions d'utilisation
  • Protection des données
  • Manage cookies
  • Communauté

  • Communauté
  • Pro Search
  • Collections
  • Enregistrer
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.