toonpool logo
  • Agent
  • Collections
  • plus
    • Communauté
    • Membres
    • Pro Search
    • Aide
  • Se connecter




    • Password lost?
  • Enregistrer
  • français
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nouveaux Cartoons
Cartoon: Impftal (medium) by leopold maurer tagged impfgipfel,impfplan,merkel,bund,länder,impfung,corona,covid,treffen,mangel,impfgipfel,impfplan,merkel,bund,länder,impfung,corona,covid,treffen,mangel

Impftal

#376600 / vu 2799 fois
leopold maurer de leopold maurer
au 01. February 2021
rating-star 5
Applause
favorite
Favori
report spam
Signaler

...

Politique »  National/Domestic  International  Health

impfgipfelimpfplanmerkelbundländerimpfungcoronacovidtreffenmangelimpfgipfelimpfplanmerkelbundländerimpfungcoronacovidtreffenmangel

Commentaires (7)

Ajouter commentaires  
markus-grolik
Member
Alternativlos...

markus-grolik, au 02. February 2021  aviser  repondre applause 0

 
Guest Avatar
Deleted
...für all die Zombies da draußen, die geimpft werden wollen!

, au 01. February 2021  aviser  repondre applause 0

 
zenundsenf
Member
die schaffen das!

zenundsenf, au 01. February 2021  aviser  repondre applause 0

 
Erl
Member
:-)))))

Erl, au 01. February 2021  aviser  repondre applause 0

 
RABE
Member
An Worten nie verlegen!*****

RABE, au 01. February 2021  aviser  repondre applause 0

 
Harm Bengen
Member
"weniger ist mehr".

Harm Bengen, au 01. February 2021  aviser  repondre applause 0

 
Barthold
Member
ein Gesicht das nach akuter Suizidgefahr aussieht

Barthold, au 01. February 2021  aviser  repondre applause 0

 
 

Ajouter commentaires
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Plus de leopold maurer


Cartoon: Ukraine Verhandlungen (small) by leopold maurer tagged putin,russland,aggression,krieg,ukraine,verhandlungen,frieden,abkommen,usa,nato,europa,gebietsabtretungen,kreml,chef,leopold,maurer,karikatur,cartoon
Ukraine Verhandlungen
Cartoon: 2G in Österreich (small) by leopold maurer tagged österreich,inzidenz,corona,covid,genesen,geimpft,test,pcr,antigen,frisör,gasthaus,theater,impfung,impfgegner,impfverweigerer,hospitalisiert,intensivstation,jodeln
2G in Österreich
Cartoon: Rechtsstreit EU Polen (small) by leopold maurer tagged polen,eu,von,der,leyen,morawiecki,rechtsstreit,rechtsstaatlichkeit,streit,konflikt,sanktionen
Rechtsstreit EU Polen
  • Service

  • ToonAgent
  • Aide
  • FAQ
  • Daily Toon
  • Sur nous

  • Sur nous
  • Contact
  • Conditions d'utilisation
  • Protection des données
  • Manage cookies
  • Communauté

  • Communauté
  • Pro Search
  • Collections
  • Enregistrer
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.