toonpool logo
  • Agent
  • Collections
  • plus
    • Communauté
    • Membres
    • Pro Search
    • Aide
  • Se connecter




    • Password lost?
  • Enregistrer
  • français
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nouveaux Cartoons
Cartoon: Der Menschensohn ohne Hut (medium) by Erwin Pischel tagged magritte,belgien,surrealismus,kunst,maler,gemälde,künstler,kunstrichtung,kunstgattung,kreativität,fantasie,mann,apfel,gesicht,krawatte,anzug,hut,blatt,mauer,pischel

Der Menschensohn ohne Hut

#456449 / vu 2387 fois
Erwin Pischel de Erwin Pischel
au 15. January 2025
rating-star 1
Applause
favorite
Favori
report spam
Signaler

Nach Magritte: "Le fils de l´homme"

Médias et Culture »  Kunst und Museen

magrittebelgiensurrealismuskunstmalergemäldekünstlerkunstrichtungkunstgattungkreativitätfantasiemannapfelgesichtkrawatteanzughutblattmauerpischel

Commentaires (0)

Ajouter commentaires  
 

Plus de Erwin Pischel


Cartoon: Kinetische Kunst aus dem KuMi BW (small) by Erwin Pischel tagged gymnasium,ausbildung,bildung,bildungspolitik,abitur,kinetische,kunst,kinetik,mobile,pischel
Kinetische Kunst aus dem KuMi BW
Cartoon: AKW-Lady (small) by Erwin Pischel tagged collage,hannah,hoech,dadaismus,photocollage,akw,atomkraftwerk,augen,mund,luftbild,reaktor,atomkraft,pischel
AKW-Lady
Cartoon: Notopfer Corona Steuermarke (small) by Erwin Pischel tagged notopfer,briefmarke,corona,deutschland,postwertzeichen,postporto,porto,michelkatalog,postsendung,berlinblockade,berlin,blockade,westberlin,brief,postkarte,wirtschaft,not,verschuldung,staat,wirtschaftsministerium,sarc,covid,virus,spike,protein,pandemie,epidemie,schulden,staatsverschuldung,milliarden,euro,cent,pischel,kredit
Notopfer Corona Steuermarke
  • Service

  • ToonAgent
  • Aide
  • FAQ
  • Daily Toon
  • Sur nous

  • Sur nous
  • Contact
  • Conditions d'utilisation
  • Protection des données
  • Manage cookies
  • Communauté

  • Communauté
  • Pro Search
  • Collections
  • Enregistrer
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.