toonpool logo
  • Agent
  • Collections
  • plus
    • Communauté
    • Membres
    • Pro Search
    • Aide
  • Se connecter




    • Password lost?
  • Enregistrer
  • français
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nouveaux Cartoons
Cartoon: Corona Weihnacht (medium) by wista tagged corona,pandemie,weihnacht,weihnachten,infektion,fest,feiern,familie,besuch,weihnachtsfest,verwandte,besuchen,risiko,virus,kinder,oma,opa,geschenk,geschenke,impfen,impfung,risikogruppe,leugner,robert,koch,institut,zahl,zahlen,mas,schiff,kreuzfahrt,reise

Corona Weihnacht

#371301 / vu 3802 fois
wista de wista
au 17. November 2020
rating-star 2
Applause
favorite
Favori
report spam
Signaler

2020

Politique »  National/Domestic  Technology  Environment  Family & Youth  Education  Jobs & Social  Historical  Other  Conflicts & War  Politicians  Parties  Privacy & Customer  Democracy

coronapandemieweihnachtweihnachteninfektionfestfeiernfamiliebesuchweihnachtsfestverwandtebesuchenrisikoviruskinderomaopageschenkgeschenkeimpfenimpfungrisikogruppeleugnerrobertkochinstitutzahlzahlenmasschiffkreuzfahrtreise

Commentaires (2)

 
wista
Member
Barthold wrote:
Idee passt - aber es sieht nicht gerade dramatisch aus . . .


Danke für den Kommentar - wird schon noch

wista, au 17. November 2020  aviser  repondre applause 0

 
Barthold
Member
Idee passt - aber es sieht nicht gerade dramatisch aus . . .

Barthold, au 17. November 2020  aviser  repondre applause 0

 
 

Ajouter commentaires

Plus de wista


Cartoon: Coronafrösche (small) by wista tagged corona,covid,pandemie,maske,masken,ffp2,frosch,frösche,storch,essen,trinken,retaurant,test,testen,2g,3g,schutzmaske,kneipe,pcr,antigen
Coronafrösche
Cartoon: Brad Pitt - Hollywood (small) by wista tagged brad,pitt,bad,pritt,hollywood,schauspieler,film,filme,klebestift,klebstoff,verwechselung,star,los,angeles,marke,berühmt,berühmtheit,filmstar,kino,name,bond,james
Brad Pitt - Hollywood
Cartoon: Corona Demo (small) by wista tagged corona,virus,demo,demonstration,protest,maske,maskenpflicht,grundrechte,altes,leben,zurück,freiheit,gesundheit,rechte,pflichten,justiz,politik,auflagen,beschränkungen,abstand,bar,kneipen,feiern,kundgebung,polizei,regeln,infektion,verschwörung,jung,alt
Corona Demo
  • Service

  • ToonAgent
  • Aide
  • FAQ
  • Daily Toon
  • Sur nous

  • Sur nous
  • Contact
  • Conditions d'utilisation
  • Protection des données
  • Manage cookies
  • Communauté

  • Communauté
  • Pro Search
  • Collections
  • Enregistrer
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.